PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G038100.3
Common NameB456_013G038100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bHLH
Protein Properties Length: 315aa    MW: 35705.1 Da    PI: 5.6608
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G038100.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH36.86.9e-12142195154
                         CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                 HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                         +++ hn+ Er RR ++  a+  L  llP++s +++k+ s a i  +AveYI +L
  Gorai.013G038100.3 142 KKQEHNAKERIRRMKLHAAYLALGALLPSDSTGSKKRKSTALIIDRAVEYIPEL 195
                         6899*************************85555555**************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474596.8E-12137206IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.109.9E-10141213IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088812.443141195IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.1E-9142196IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.6E-6147201IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MSSLHLENLF SIPEATDEYL WPLTQDNKDD DYTIEDNART GDQLGTTSKF ILESVDHNIV  60
GESMESILDY PIDVSLSAPL EDLDDIDLVP HESSSRQLPS TYQETGDAHI NAKRISSKTR  120
GRNHRFKQGL NMEDNGEGTT MKKQEHNAKE RIRRMKLHAA YLALGALLPS DSTGSKKRKS  180
TALIIDRAVE YIPELEKEIE KLTLRKNDML STIKNKKSCA VLNHFQLRQP SVSVHEIKQG  240
EFIVQICTQE YPDCSFLNLL HNVEEEEGIC IISASTHQVS DHGHCYHLHI QMHERLDGEN  300
HIASLREKLM YSQG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6145441e-155JX614544.1 Gossypium hirsutum clone NBRI_GE58013 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465252.10.0PREDICTED: transcription factor bHLH101 isoform X3
TrEMBLA0A0D2TUB50.0A0A0D2TUB5_G
STRINGVIT_12s0034g02150.t011e-39(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71200.11e-20bHLH family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]